PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G076600.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 328aa    MW: 37162.9 Da    PI: 4.5176
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G076600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.45.7e-1960113356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        k+++++ +q+++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Aqcoe6G076600.2.p  60 KKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 113
                        566899***********************************************9 PP

2HD-ZIP_I/II130.28e-4259151193
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        ekkrrls +qvk+LE++Fe e+kLeperKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy  Lk++yd+lk++ e+L++++e+L +elk
  Aqcoe6G076600.2.p  59 EKKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGILKANYDSLKQNFEALQHDKEALLAELK 150
                        69***************************************************************************************998 PP

        HD-ZIP_I/II  93 e 93 
                        e
  Aqcoe6G076600.2.p 151 E 151
                        7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.13E-1943117IPR009057Homeodomain-like
PROSITE profilePS5007117.50855115IPR001356Homeobox domain
SMARTSM003896.3E-1858119IPR001356Homeobox domain
PfamPF000463.7E-1660113IPR001356Homeobox domain
CDDcd000864.65E-1660116No hitNo description
Gene3DG3DSA:1.10.10.606.2E-2062121IPR009057Homeodomain-like
PRINTSPR000319.4E-68695IPR000047Helix-turn-helix motif
PROSITE patternPS00027090113IPR017970Homeobox, conserved site
PRINTSPR000319.4E-695111IPR000047Helix-turn-helix motif
PfamPF021832.6E-16115155IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MKRLNSSDSL GGVMSICQST DEKSLGSKNN NLVYSRGFQS MLDGLDEEDC LEESGQISEK  60
KRRLSVDQVK ALEKNFEVEN KLEPERKVKL AQELGLQPRQ VAVWFQNRRA RWKTKQLERD  120
YGILKANYDS LKQNFEALQH DKEALLAELK ELKSKQGEES TDHSNVSIKE EIMVPESENK  180
ALDEDKISAT ELVETEITDL NQDFYKSNNE VEASLYADFK DGSSDSDSSA IFNDDNSLHS  240
SSGVLQQHLL MSPSSSSLRF SCSSPSSING FQFADSKGNS VNPQKTYQTH QFVKMEEHNF  300
FGSEEPCNFF SEEQAPTLQW YCPDQWN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1107115RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00051PBMTransfer from AT4G40060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010266919.11e-150PREDICTED: homeobox-leucine zipper protein ATHB-6-like
RefseqXP_010272979.11e-150PREDICTED: homeobox-leucine zipper protein ATHB-6-like
TrEMBLB9H4Q51e-134B9H4Q5_POPTR; Uncharacterized protein
STRINGPOPTR_0005s07290.11e-134(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.11e-56homeobox protein 16